Customization: | Available |
---|---|
Powder: | Yes, Yes |
Customized: | Customized, Customized |
Suppliers with verified business licenses
Product Name: | Glucagon |
Synonyms: | GLUCAGON 1-37;GLUCAGON (1-37) (PORCINE);GLUCAGON 37;GLUCAGON ACETATE;HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA;H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH;Glucagon 1-29;Glucagon(1-29) Human HCl |
CAS: | 16941-32-5 |
MF: | C153H225N43O49S |
MW: | 3482.75 |
EINECS: | 685-611-6 |
Product Categories: | Amino Acid Derivatives;Peptide;GlucagonIslet Stem Cell Biology;Islet Stem Cell Differentiation;Hormones;Other Protein/Pep tide Horm ones;Glucagon and Glucagon-Like PeptidesPeptides for Cell Biology;GlucagonsIslet Stem Cell Biology;Cytokines Growth Factors and Hormones (Obesity);Gastrointestinal Peptides;GlucagonObesity Research;API;Diabetes Research;16941-32-5 |
Mol File: | 16941-32-5.mol |
Q&A
1.How could l get a sample?
Before we received the first order, please afford the sample cost and express fee. We will return the sample cost back to you within your first order.
2.Can you make designs for us?
We have a professional design team to help our customers do design work.Both OEM and ODM orders are accepted.
3.Whether you could make our brand on your products?
Yes. We can print your Logo on both the products and the packages if you can meet our MOQ.
4.How can you provide us high quality products?
We have a professional QC team, every product is shipped after strictly examination.
5.What is your lead time?
7-15days, We will update you eact two-three days!
6.What is your payment?
We accept T/T.L/C.Paypal.Westem union or to be negotiated.Don't worry about anything, if you have any problems, please feel free to contact us