1.For some materials, we could supply free Samples for testing at first..
2.MOQ: 1g or 5g
3.More than 3000 kinds of materials in stock.
4.More than 11+ manufacturing experience.
5.Certification: MSDS,HALAL,COA,IFRA,ISO9001, ISO22000,26 Allergens, etc.
6.Lead time:about 8-12 working days.
8.Verified by Made-in-China as Golden Supplier.
9.We will reply you for your inquiry in 24 hours.
10. Our Q&C team will inspect every product quality strictly before delivery.
What is CAS 154947-66-7 LL-37 Powder?
Product Name: |
LL-37 |
Synonyms: |
Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate |
CAS: |
154947-66-7 |
MF: |
C205H340N60O53 |
MW: |
0 |
EINECS: |
211-519-9 |
Product Categories: |
|
Mol File: |
Mol File |
L 37 (human) is a 37 amino acid host defense peptide originating from the C-terminal of the human cathelicidin antimicrobial peptide (CAMP, hCAP18). This peptide possesses antimicrobial, antitumor, antiviral, and immunomodulatory properties, along with physiological functions in chemotaxis, wound healing, and angiogenesis. Beyond its antimicrobial capabilities, LL 37 (human) influences various pathways in autoimmune and inflammatory diseases, playing a role in the development of lupus, rheumatoid arthritis, and atherosclerosis. As a binding partner to Aβ42, the expression of LL 37 (human) affects the onset and progression of Alzheimer's disease. Additionally, LL 37 has a notable role in human cancer, promoting tumorigenic effects in ovarian, lung, breast, prostate, pancreatic cancers, and malignant melanoma.
ShangHai Pemichem is one of professional company specialized in research, development, custom manufacturing and trading of pharmaceutical API, advanced intermediates, Cosmetic raw materials, health and new raw materials, polypeptides, animal drug and organic reagent etc.
You can select more than 2000 kinds of raw ingredients here. And we are keeping developing new products and continuously marketing them for sale. You will save lots of time , energy, money and have a very pleasant cooperation with us!
Our purpose: Trransaction is not the end, but the satarting of service!
Q&A
1.How could l get a sample?
Before we received the first order, please afford the sample cost and express fee. We will return the sample cost back to you within your first order.
2.Can you make designs for us?
We have a professional design team to help our customers do design work.Both OEM and ODM orders are accepted.
3.Whether you could make our brand on your products?
Yes. We can print your Logo on both the products and the packages if you can meet our MOQ.
4.How can you provide us high quality products?
We have a professional QC team, every product is shipped after strictly examination.
5.What is your lead time?
7-15days, We will update you eact two-three days!
6.What is your payment?
We accept T/T.L/C.Paypal.Westem union or to be negotiated.Don't worry about anything, if you have any problems, please feel free to contact us