Shanghai Pemichem Lab Supply Raw Materials Pharmaceutical Intermediates Powder Ll-37 CAS 154947-66-7 API with 99% Pruity

Product Details
CAS No.: 154947-66-7
Formula: C205h340n60o53
EINECS: 211-519-9
Gold Member Since 2024

Suppliers with verified business licenses

Business Range
Agriculture & Food
Main Products
Flavor, API, Intermediate
  • Shanghai Pemichem Lab Supply Raw Materials Pharmaceutical Intermediates Powder Ll-37 CAS 154947-66-7 API with 99% Pruity
  • Shanghai Pemichem Lab Supply Raw Materials Pharmaceutical Intermediates Powder Ll-37 CAS 154947-66-7 API with 99% Pruity
  • Shanghai Pemichem Lab Supply Raw Materials Pharmaceutical Intermediates Powder Ll-37 CAS 154947-66-7 API with 99% Pruity
  • Shanghai Pemichem Lab Supply Raw Materials Pharmaceutical Intermediates Powder Ll-37 CAS 154947-66-7 API with 99% Pruity
  • Shanghai Pemichem Lab Supply Raw Materials Pharmaceutical Intermediates Powder Ll-37 CAS 154947-66-7 API with 99% Pruity
  • Shanghai Pemichem Lab Supply Raw Materials Pharmaceutical Intermediates Powder Ll-37 CAS 154947-66-7 API with 99% Pruity
Find Similar Products

Basic Info.

Model NO.
Pemi-0515
Classification
Pharmaceutical Grade
Grade
GR
Content
Standard
Usage
Laboratory Reagents
Source
Concrete
Habit Appellation
Fine Chemicals
Application
Scientific Research
Property
Organic Reagent
MW
0
Transport Package
Penicillin Bottle, Aluminium Foil Bag
Specification
1g, 100g
Origin
Shanghai
Production Capacity
5000kg/Year

Product Description

Shanghai Pemichem Lab Supply Raw Materials Pharmaceutical Intermediates Powder Ll-37 CAS 154947-66-7 API with 99% Pruity


Shanghai Pemichem Lab Supply Raw Materials Pharmaceutical Intermediates Powder Ll-37 CAS 154947-66-7 API with 99% Pruity
1.For some materials, we could supply free Samples for testing at first..
2.MOQ: 1g or 5g
3.More than 3000 kinds of materials in stock.
4.More than 11+ manufacturing experience.
5.Certification: MSDS,HALAL,COA,IFRA,ISO9001, ISO22000,26 Allergens, etc.
6.Lead time:about 8-12 working days.
8.Verified by Made-in-China as Golden Supplier.

9.We will reply you for your inquiry in 24 hours.
10. Our Q&C team will inspect every product quality strictly before delivery.






Shanghai Pemichem Lab Supply Raw Materials Pharmaceutical Intermediates Powder Ll-37 CAS 154947-66-7 API with 99% Pruity


What is CAS 154947-66-7 LL-37 Powder? 
 
Product Name: LL-37
Synonyms: Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate
CAS: 154947-66-7
MF: C205H340N60O53
MW: 0
EINECS: 211-519-9
Product Categories:  
Mol File: Mol File
  
 
L 37 (human) is a 37 amino acid host defense peptide originating from the C-terminal of the human cathelicidin antimicrobial peptide (CAMP, hCAP18). This peptide possesses antimicrobial, antitumor, antiviral, and immunomodulatory properties, along with physiological functions in chemotaxis, wound healing, and angiogenesis. Beyond its antimicrobial capabilities, LL 37 (human) influences various pathways in autoimmune and inflammatory diseases, playing a role in the development of lupus, rheumatoid arthritis, and atherosclerosis. As a binding partner to Aβ42, the expression of LL 37 (human) affects the onset and progression of Alzheimer's disease. Additionally, LL 37 has a notable role in human cancer, promoting tumorigenic effects in ovarian, lung, breast, prostate, pancreatic cancers, and malignant melanoma.
 
 
Shanghai Pemichem Lab Supply Raw Materials Pharmaceutical Intermediates Powder Ll-37 CAS 154947-66-7 API with 99% Pruity


 
Shanghai Pemichem Lab Supply Raw Materials Pharmaceutical Intermediates Powder Ll-37 CAS 154947-66-7 API with 99% Pruity
 
 
 
Shanghai Pemichem Lab Supply Raw Materials Pharmaceutical Intermediates Powder Ll-37 CAS 154947-66-7 API with 99% Pruity
 
 



ShangHai Pemichem is one of professional company specialized in research, development, custom manufacturing and trading of pharmaceutical API, advanced intermediates, Cosmetic raw materials, health and new raw materials, polypeptides, animal drug and organic reagent  etc. 
You can select more than 2000 kinds of raw ingredients here. And we are keeping developing new products and continuously marketing them for sale. You will save lots of time , energy, money and have a very pleasant cooperation with us!

Our purpose: Trransaction is not the end, but the satarting of service!


 

Q&A

1.How could l get a sample?
Before we received the first order, please afford the sample cost and express fee. We will return the sample cost back to you within your first order.

2.Can you make designs for us?
We have a professional design team to help our customers do design work.Both OEM and ODM    orders are accepted.


3.Whether you could make our brand on your products?
Yes. We can print your Logo on both the products and the packages if you can meet our MOQ.

4.How can you provide us high quality products?
We have a professional QC team, every product is shipped after strictly examination.

5.What is your lead time?
7-15days, We will update you eact two-three days!

6.What is your payment?
We accept T/T.L/C.Paypal.Westem union or to be negotiated.Don't worry about anything, if you have      any problems, please feel free to contact us

 
 
 
 
 
 

Send your message to this supplier

*From:
*To:
*Message:

Enter between 20 to 4,000 characters.

This is not what you are looking for? Post a Sourcing Request Now
Contact Supplier
People who viewed this also viewed